PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN29600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 174aa    MW: 19908.3 Da    PI: 6.5307
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN29600.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.71.9e-081221552154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp++e++++L +++gL+ +q+ +WF N+R +
  KHN29600.1 122 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 155
                 469*****************************87 PP

2ELK30.48.6e-117697122
         ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                ELKh+L+++Y+++++++++E++
  KHN29600.1 76 ELKHELKQGYKEKIVDIREEIL 97
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.9697696IPR005539ELK domain
SMARTSM011886.1E-47697IPR005539ELK domain
PfamPF037893.1E-77697IPR005539ELK domain
PROSITE profilePS5007111.72696159IPR001356Homeobox domain
SuperFamilySSF466898.55E-1798162IPR009057Homeodomain-like
SMARTSM003894.7E-1198163IPR001356Homeobox domain
CDDcd000869.39E-1299160No hitNo description
Gene3DG3DSA:1.10.10.609.3E-26103160IPR009057Homeodomain-like
PfamPF059203.1E-18116155IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MEAVMACWEI EQSLQSLTGV SPGEGTGATM SDEEDEQVDS DANLFDGALD GPDSMGFGPL  60
IPTENERSLM ERVRHELKHE LKQGYKEKIV DIREEILRKR RAGKLPGDTT SVLKAWWQSH  120
SKWPYPTEED KARLVQETGL QLKQINNWFI NQRKRNWHSN PSTSTALKSK RKRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A8e-1499163872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152172RKRNWHSNPSTSTALKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1280601e-169EF128060.1 Medicago truncatula class II KNOX homeobox transcription factor (KNOX5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522507.11e-126PREDICTED: homeobox protein knotted-1-like 3 isoform X2
SwissprotP480001e-113KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0B2R7P71e-128A0A0B2R7P7_GLYSO; Homeobox protein knotted-1-like 3
TrEMBLI1JU991e-126I1JU99_SOYBN; Uncharacterized protein
STRINGGLYMA04G06810.11e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-115KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]